PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa06g001330.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HD-ZIP
Protein Properties Length: 202aa    MW: 22823.7 Da    PI: 7.565
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa06g001330.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox581.6e-1866120256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ ++t+eq + Le+ F++n++++ +++e LA++l L  rq+ vWFqNrRa+ k
  Csa06g001330.1  66 RKKLRLTREQSRLLEDSFRQNHTLNPKQKEALATHLMLRPRQIEVWFQNRRARSK 120
                     78889************************************************98 PP

2HD-ZIP_I/II118.44e-3866154189
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                     +kk+rl++eq++lLE+sF+++++L+p++K++la++L l+prq++vWFqnrRAR k+kq+E+++e+Lkr++ +l+e+n+rL++eveeLr+
  Csa06g001330.1  66 RKKLRLTREQSRLLEDSFRQNHTLNPKQKEALATHLMLRPRQIEVWFQNRRARSKLKQTEMECEYLKRWFGSLTEQNHRLHREVEELRA 154
                     69*************************************************************************************94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.7E-1947120IPR009057Homeodomain-like
SuperFamilySSF466891.97E-1848123IPR009057Homeodomain-like
PROSITE profilePS5007116.89262122IPR001356Homeobox domain
SMARTSM003899.0E-1764126IPR001356Homeobox domain
CDDcd000862.42E-1565123No hitNo description
PfamPF000468.8E-1666120IPR001356Homeobox domain
PROSITE patternPS00027097120IPR017970Homeobox, conserved site
SMARTSM003407.0E-22122165IPR003106Leucine zipper, homeobox-associated
PfamPF021831.4E-9122156IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MAILPENSSN LDLTISVPGF SSSPPSVSDE GSGGGREQLK LDMNRVPSSE DGDDEEFSHD  60
GSAPPRKKLR LTREQSRLLE DSFRQNHTLN PKQKEALATH LMLRPRQIEV WFQNRRARSK  120
LKQTEMECEY LKRWFGSLTE QNHRLHREVE ELRAMKVGPP TVNSASSLTM CPRCERVTTP  180
ASPASMAVPA REKFPPQERE D*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1114122RRARSKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4311810.0AJ431181.1 Arabidopsis thaliana mRNA for homeodomain-leucine zipper (Athb17 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010424911.11e-144PREDICTED: homeobox-leucine zipper protein ATHB-17 isoform X2
RefseqXP_010424910.11e-144PREDICTED: homeobox-leucine zipper protein ATHB-17 isoform X1
SwissprotQ8S9N61e-129ATB17_ARATH; Homeobox-leucine zipper protein ATHB-17
TrEMBLR0HHK21e-133R0HHK2_9BRAS; Uncharacterized protein (Fragment)
STRINGfgenesh1_pg.C_scaffold_50000311e-132(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM48902747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01430.11e-113homeobox-leucine zipper protein 17